PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G150680_P01
Common NameLOC100381651, ZEAMMB73_846054
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB
Protein Properties Length: 431aa    MW: 47137.6 Da    PI: 5.8808
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G150680_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.1e-17115160147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +g+WT eEd +l d v  +G g+W+++a+ ++ gR +kqc++rw ++
  GRMZM2G150680_P01 115 KGPWTMEEDSILRDMVMHHGEGRWSLVAQSLP-GRIGKQCRERWINH 160
                        79******************************.***********997 PP

2Myb_DNA-binding41.23.7e-13171212447
                        S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        WT+eEd  l++a+k +G++ W+tIa+ ++ g  ++ +k++w++ 
  GRMZM2G150680_P01 171 WTEEEDIVLIQAHKSFGSH-WSTIAKFLP-GWPENAIKNHWNST 212
                        *******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-24109163IPR009057Homeodomain-like
PROSITE profilePS5129425.41110165IPR017930Myb domain
SuperFamilySSF466891.91E-28113209IPR009057Homeodomain-like
SMARTSM007171.8E-14114163IPR001005SANT/Myb domain
PfamPF002497.5E-16115160IPR001005SANT/Myb domain
CDDcd001677.46E-14117161No hitNo description
Gene3DG3DSA:1.10.10.601.5E-16164214IPR009057Homeodomain-like
SMARTSM007171.3E-11167215IPR001005SANT/Myb domain
PROSITE profilePS5129413.491167217IPR017930Myb domain
CDDcd001678.02E-11171213No hitNo description
PfamPF002495.1E-11171211IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MESDESAFLN NMLAPPMAPD KRTKRYFASS SHGHILFEQD LLATSSMQAS DAQLMGDPLE  60
ARSLVASIGM TPAGFEMPEG EILSRGYHAL GGTPVDIAPA PQPQIESSNK PTAFKGPWTM  120
EEDSILRDMV MHHGEGRWSL VAQSLPGRIG KQCRERWINH VDPNIKKNDI WTEEEDIVLI  180
QAHKSFGSHW STIAKFLPGW PENAIKNHWN STKRSLGSKR RLKKKKSQQA PPGQLSVLEE  240
YIRSLESDSS SAAPPAATSR PAIGRPRRAV HTSAVPEMEL HLSAPNNQDA PVRHQPRAIS  300
QGNPMLPDLN VSYDPEETHY MGYPMYDPAA APQLQLVSQE PRQATFTWLP FGGPRMALNG  360
EHASGPSSYD VGGSSGNAGY YSEAGPSNVG GSGGDGQADD DTTNNDDLDL ASREFFMPSC  420
DEVRLGLARF K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-371152144102MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-371152144102C-Myb DNA-Binding Domain
1msf_C3e-371152144102C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.195870.0endosperm
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G150680
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G150680_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0618820.0BT061882.1 Zea mays full-length cDNA clone ZM_BFb0194A15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001167937.10.0putative MYB DNA-binding domain superfamily protein
TrEMBLC0HHS60.0C0HHS6_MAIZE; Putative MYB DNA-binding domain superfamily protein
STRINGGRMZM2G150680_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.12e-37myb domain protein 3r-3